Recombinant Human CAMTA2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O94983

Gene Name: CAMTA2

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Glu811

End Site: Pro1000

Coverage: 0.16

Isoelectric Point: 4

Core Sequence: ELQRQEPSVEPPFALSPPSSSPDTGLSSVSSPSELSDGTFSVTSAYSSAPDGSPPPAPLPASEMTMEDMAPGQLSSGVPEAPLLLMDYEATNSKGPLSSLPALPPASDDGAAPEDADSPQAVDVIPVDMISLAKQIIEATPERIKREDFVGLPEAGASMRERTGAVGLSETMSWLASYLENVDHFPSSTP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Pig - 88%, Cynomolgus monkey - 98%

Alternative gene names: KIAA0909

Alternative protein names: Calmodulin-binding transcription activator 2

Protein name: calmodulin binding transcription activator 2

Full length: 1202 amino acids

Entry name: CMTA2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10411-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10411-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 23125