Recombinant Human CAPN7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6W3

Gene Name: CAPN7

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Val11

End Site: Lys130

Coverage: 0.16

Isoelectric Point: 5

Core Sequence: VQFARLAVQRDHEGRYSEAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSAVQSKSADPLKSKHQLDLERAHFLVTQAFDEDEKENVEDAIELYTEAVDLCLKTSYETADK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Pig - 96%

Alternative gene names: PALBH

Alternative protein names: Calpain-7; PalB homolog; PalBH

Protein name: calpain 7

Full length: 813 amino acids

Entry name: CAN7_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3001-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3001-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 23473