Recombinant Human CBLC Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULV8

Gene Name: CBLC

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Val361

End Site: Asp470

Coverage: 0.25

Isoelectric Point: 7

Core Sequence: VKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQEGRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Rat - 65%

Alternative gene names: CBL3; RNF57

Alternative protein names: E3 ubiquitin-protein ligase CBL-C; RING finger protein 57; RING-type E3 ubiquitin transferase CBL-C; SH3-binding protein CBL-3; SH3-binding protein CBL-C; Signal transduction protein CBL-C

Protein name: Cbl proto-oncogene C

Full length: 474 amino acids

Entry name: CBLC_HUMAN

Product panel: E3 Ligase,Enzyme

• SKU: ASBPP-11688-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-11688-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 23624