Recombinant Human CCL16 Protein

Recombinant Human CCL16 Protein
SKU
ASBPP-3667-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O15467

Gene Name: CCL16

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 42%

Start Site: Gln24

End Site: Gln120

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 42%, Rat - 39%, Pig - 68%, Cynomolgus monkey - 90%

Alternative gene names: ILINCK; NCC4; SCYA16

Alternative protein names: C-C motif chemokine 16; Chemokine CC-4; HCC-4; Chemokine LEC; IL-10-inducible chemokine; LCC-1; Liver-expressed chemokine; Lymphocyte and monocyte chemoattractant; LMC; Monotactin-1; MTN-1; NCC-4; Small-inducible cytokine A16

Protein name: C-C motif chemokine ligand 16

Full length: 120 amino acids

Entry name: CCL16_HUMAN

Product panel: Cytokines
More Information
SKU ASBPP-3667-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3667-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 6360
Product information (PDF)
×
MSDS (PDF)
×