Recombinant Human CCL17 Protein

Recombinant Human CCL17 Protein
SKU
ASBPP-3150-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q92583

Gene Name: CCL17

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Ala24

End Site: Ser94

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Rat - 67%, Pig - 77%, Cynomolgus monkey - 90%

Alternative gene names: SCYA17; TARC

Alternative protein names: C-C motif chemokine 17; CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine

Protein name: C-C motif chemokine ligand 17

Full length: 94 amino acids

Entry name: CCL17_HUMAN
More Information
SKU ASBPP-3150-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3150-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6361
Product information (PDF)
×
MSDS (PDF)
×