Recombinant Human CCL26 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y258

Gene Name: CCL26

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 48%

Start Site: Thr24

End Site: Leu94

Coverage: 1.00

Isoelectric Point: 9.5

Core Sequence: TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 48%, Rat - 48%, Pig - 73%, Cynomolgus monkey - 83%

Alternative gene names: SCYA26

Alternative protein names: C-C motif chemokine 26; CC chemokine IMAC; Eotaxin-3; Macrophage inflammatory protein 4-alpha; MIP-4-alpha; Small-inducible cytokine A26; Thymic stroma chemokine-1; TSC-1

Protein name: C-C motif chemokine ligand 26

Full length: 94 amino acids

Entry name: CCL26_HUMAN

Product panel: Cytokines

• SKU: ASBPP-3162-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3162-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 10344