Recombinant Human CCL27 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y4X3

Gene Name: CCL27

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Phe25

End Site: Gly112

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Pig - 75%, Cynomolgus monkey - 98%

Alternative gene names: ILC; SCYA27

Alternative protein names: C-C motif chemokine 27; CC chemokine ILC; Cutaneous T-cell-attracting chemokine; CTACK; ESkine; IL-11 R-alpha-locus chemokine; Skinkine; Small-inducible cytokine A27

Protein name: C-C motif chemokine ligand 27

Full length: 112 amino acids

Entry name: CCL27_HUMAN

• SKU: ASBPP-3163-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3163-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 10850