Recombinant Human CCL8 Protein

Recombinant Human CCL8 Protein
SKU
ASBPP-3672-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P80075

Gene Name: CCL8

Expression System: Escherichia coli

Molecular Weight: 51.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: Gln24

End Site: Pro99

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Rat - 58%, Pig - 72%, Cynomolgus monkey - 95%

Alternative gene names: MCP2; SCYA10; SCYA8

Alternative protein names: C-C motif chemokine 8; HC14; Monocyte chemoattractant protein 2; Monocyte chemotactic protein 2; MCP-2; Small-inducible cytokine A8) [Cleaved into: MCP-2(6-76]

Protein name: C-C motif chemokine ligand 8

Full length: 99 amino acids

Entry name: CCL8_HUMAN

Product panel: Cytokines
More Information
SKU ASBPP-3672-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3672-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6355
Product information (PDF)
×
MSDS (PDF)
×