Recombinant Human CCNI Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q14094

Gene Name: CCNI

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Lys291

End Site: Pro370

Coverage: 0.22

Isoelectric Point: 6.5

Core Sequence: KDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNVSENVGSVCGTDLSRQEGHASPCPP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Pig - 92%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Cyclin-I

Protein name: cyclin I

Full length: 377 amino acids

Entry name: CCNI_HUMAN

• SKU: ASBPP-3669-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3669-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 10983