Recombinant Human CCS Protein

Recombinant Human CCS Protein
SKU
ASBPP-4114-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O14618

Gene Name: CCS

Expression System: Escherichia coli

Molecular Weight: 30 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Met1

End Site: Leu274

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 89%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Copper chaperone for superoxide dismutase; Superoxide dismutase copper chaperone

Protein name: copper chaperone for superoxide dismutase

Full length: 274 amino acids

Entry name: CCS_HUMAN
More Information
SKU ASBPP-4114-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4114-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9973
Product information (PDF)
×
MSDS (PDF)
×