Recombinant Human CD1C Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P29017

Gene Name: CD1C

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 39%

Start Site: Ala21

End Site: Gly130

Coverage: 0.35

Isoelectric Point: 5.5

Core Sequence: ASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 39%, Rat - 41%, Pig - 59%, Cynomolgus monkey - 88%

Alternative gene names: /

Alternative protein names: T-cell surface glycoprotein CD1c; CD antigen CD1c

Protein name: CD1c molecule

Full length: 333 amino acids

Entry name: CD1C_HUMAN

CD Antigen: CD1c

Product panel: CD Antigen

• SKU: ASBPP-3220-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3220-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 911