Recombinant Human CD300E Protein

Recombinant Human CD300E Protein
SKU
ASBPP-3186-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q496F6

Gene Name: CD300E

Expression System: Escherichia coli

Molecular Weight: 27 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Pro21

End Site: Pro140

Coverage: 0.66

Isoelectric Point: 6

Core Sequence: PGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Rat - 53%, Pig - 43%, Cynomolgus monkey - 93%

Alternative gene names: CD300LE; CLM2; CMRF35A5; IREM2

Alternative protein names: CMRF35-like molecule 2; CLM-2; CD300 antigen-like family member E; CMRF35-A5; Immune receptor expressed on myeloid cells 2; IREM-2; Polymeric immunoglobulin receptor 2; PIgR-2; PIgR2; Poly-Ig receptor 2; CD antigen CD300e

Protein name: CD300e molecule

Full length: 205 amino acids

Entry name: CLM2_HUMAN

CD Antigen: CD300e

Product panel: CD Antigen
More Information
SKU ASBPP-3186-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3186-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 342510
Product information (PDF)
×
MSDS (PDF)
×