Recombinant Human CD302 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IX05

Gene Name: CD302

Expression System: Escherichia coli

Molecular Weight: 28.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Gln41

End Site: Lys160

Coverage: 0.65

Isoelectric Point: 4.5

Core Sequence: QEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Rat - 82%, Pig - 91%, Cynomolgus monkey - 96%

Alternative gene names: CLEC13A; DCL1; KIAA0022

Alternative protein names: CD302 antigen; C-type lectin BIMLEC; C-type lectin domain family 13 member A; DEC205-associated C-type lectin 1; Type I transmembrane C-type lectin receptor DCL-1; CD antigen CD302

Protein name: CD302 molecule

Full length: 232 amino acids

Entry name: CD302_HUMAN

CD Antigen: CD302

Product panel: CD Antigen

• SKU: ASBPP-3185-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3185-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 9936