Note: Dry Ice fees will be extra-charged
Uniprot: P08962-1
Gene Name: CD63
Expression System: Escherichia coli
Molecular Weight: 12.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: N-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 67%
Start Site: Val111
End Site: Arg200
Coverage: 0.42
Isoelectric Point: 8.5
Core Sequence: VMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLR
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Rat - 66%, Pig - 78%, Cynomolgus monkey - 100%
Alternative gene names: MLA1; TSPAN30
Alternative protein names: CD63 antigen; Granulophysin; Lysosomal-associated membrane protein 3; LAMP-3; Lysosome integral membrane protein 1; Limp1; Melanoma-associated antigen ME491; OMA81H; Ocular melanoma-associated antigen; Tetraspanin-30; Tspan-30; CD antigen CD63
Protein name: CD63 molecule
Full length: 238 amino acids
Entry name: CD63_HUMAN
CD Antigen: CD63
Product panel: IHC Pathology,CD Antigen
English
Deutsch
