Recombinant Human CDH4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P55283

Gene Name: CDH4

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Lys761

End Site: Gly840

Coverage: 0.11

Isoelectric Point: 5.5

Core Sequence: KERHTKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPEAMGHVPSKAPGVRRVDERPVGAEPQYPIRPMVPHPG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 75%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Cadherin-4; Retinal cadherin; R-CAD; R-cadherin

Protein name: cadherin 4

Full length: 916 amino acids

Entry name: CADH4_HUMAN

• SKU: ASBPP-315-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-315-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1002