Recombinant Human CDK11A Protein

Recombinant Human CDK11A Protein
SKU
ASBPP-2948-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UQ88

Gene Name: CDK11A

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Lys11

End Site: Glu120

Coverage: 0.15

Isoelectric Point: 8.5

Core Sequence: KTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHCMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKVHHRKDEKRKEKWKHARVKEREHE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Pig - 89%, Cynomolgus monkey - 89%

Alternative gene names: CDC2L2; CDC2L3; PITSLREB

Alternative protein names: Cyclin-dependent kinase 11A; Cell division cycle 2-like protein kinase 2; Cell division protein kinase 11A; Galactosyltransferase-associated protein kinase p58/GTA; PITSLRE serine/threonine-protein kinase CDC2L2

Protein name: cyclin dependent kinase 11A

Full length: 783 amino acids

Entry name: CD11A_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-2948-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2948-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 728642
Product information (PDF)
×
MSDS (PDF)
×