Recombinant Human CDX1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P47902

Gene Name: CDX1

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Thr151

End Site: Lys260

Coverage: 0.43

Isoelectric Point: 10.5

Core Sequence: TRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Rat - 79%, Pig - 84%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Homeobox protein CDX-1; Caudal-type homeobox protein 1

Protein name: caudal type homeobox 1

Full length: 265 amino acids

Entry name: CDX1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-4053-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4053-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1044