Recombinant Human CDY2A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6F7

Gene Name: CDY2A,CDY2B

Expression System: Escherichia coli

Molecular Weight: 26 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 49%

Start Site: Ile11

End Site: Ala220

Coverage: 0.40

Isoelectric Point: 10

Core Sequence: IVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRRQTEKQKKLTWTTTSRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNCKLFAASKNVRRKAASTLSDTKNMEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSHPGAEQTGIQNKTQMHPLMSQMSGSVTASMA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 49%, Rat - 47%

Alternative gene names: CDY2

Alternative protein names: Testis-specific chromodomain protein Y 2

Protein name: chromodomain Y-linked 2A,chromodomain Y-linked 2B

Full length: 541 amino acids

Entry name: CDY2_HUMAN

Product panel: Enzyme

• SKU: ASBPP-2996-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2996-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 9426