Recombinant Human CEND1 Protein

Recombinant Human CEND1 Protein
SKU
ASBPP-4141-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8N111

Gene Name: CEND1

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Pro11

End Site: Glu120

Coverage: 0.83

Isoelectric Point: 8

Core Sequence: PKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQPPAAPTTAPAKKTSAKADPALLNNHSNLKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 77%, Pig - 71%, Cynomolgus monkey - 89%

Alternative gene names: BM88

Alternative protein names: Cell cycle exit and neuronal differentiation protein 1; BM88 antigen

Protein name: cell cycle exit and neuronal differentiation 1

Full length: 149 amino acids

Entry name: CEND_HUMAN
More Information
SKU ASBPP-4141-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4141-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 51286
Product information (PDF)
×
MSDS (PDF)
×