Recombinant Human CEND1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N111

Gene Name: CEND1

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Pro11

End Site: Glu120

Coverage: 0.83

Isoelectric Point: 8

Core Sequence: PKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQPPAAPTTAPAKKTSAKADPALLNNHSNLKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 77%, Pig - 71%, Cynomolgus monkey - 89%

Alternative gene names: BM88

Alternative protein names: Cell cycle exit and neuronal differentiation protein 1; BM88 antigen

Protein name: cell cycle exit and neuronal differentiation 1

Full length: 149 amino acids

Entry name: CEND_HUMAN

• SKU: ASBPP-4141-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4141-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 51286