Recombinant Human CENPC Protein

Recombinant Human CENPC Protein
SKU
ASBPP-382-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q03188

Gene Name: CENPC

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 43%

Start Site: Glu151

End Site: Lys230

Coverage: 0.08

Isoelectric Point: 6

Core Sequence: EFYLSVGSPSVLLDAKTSVSQNVIPSSAQKRETYTFENSVNMLPSSTEVSVKTKKRLNFDDKVMLKKIEIDNKVSDEEDK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 43%, Pig - 68%, Cynomolgus monkey - 93%

Alternative gene names: CENPC1; ICEN7

Alternative protein names: Centromere protein C; CENP-C; Centromere autoantigen C; Centromere protein C 1; CENP-C 1; Interphase centromere complex protein 7

Protein name: centromere protein C

Full length: 943 amino acids

Entry name: CENPC_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-382-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-382-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1060
Product information (PDF)
×
MSDS (PDF)
×