Recombinant Human CERT1 Protein

Recombinant Human CERT1 Protein
SKU
ASBPP-1039-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5P4

Gene Name: CERT1

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Leu161

End Site: Ser340

Coverage: 0.31

Isoelectric Point: 6

Core Sequence: LAEMETFRDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHSTNGNKEKLFPHVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: CERT; COL4A3BP; STARD11

Alternative protein names: Ceramide transfer protein; hCERT; Collagen type IV alpha-3-binding protein; Goodpasture antigen-binding protein; GPBP; START domain-containing protein 11; StARD11; StAR-related lipid transfer protein 11

Protein name: ceramide transporter 1

Full length: 624 amino acids

Entry name: CERT_HUMAN
More Information
SKU ASBPP-1039-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-1039-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 10087
Product information (PDF)
×
MSDS (PDF)
×