Recombinant Human CFH Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P08603

Gene Name: CFH

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Cys21

End Site: Ile140

Coverage: 0.10

Isoelectric Point: 5.5

Core Sequence: CNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 29%, Pig - 70%, Cynomolgus monkey - 92%

Alternative gene names: HF; HF1; HF2

Alternative protein names: Complement factor H; H factor 1

Protein name: complement factor H

Full length: 1231 amino acids

Entry name: CFAH_HUMAN

• SKU: ASBPP-3671-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3671-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3075