Recombinant Human CFH Protein

Recombinant Human CFH Protein
SKU
ASBPP-3671-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P08603

Gene Name: CFH

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Cys21

End Site: Ile140

Coverage: 0.10

Isoelectric Point: 5.5

Core Sequence: CNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 29%, Pig - 70%, Cynomolgus monkey - 92%

Alternative gene names: HF; HF1; HF2

Alternative protein names: Complement factor H; H factor 1

Protein name: complement factor H

Full length: 1231 amino acids

Entry name: CFAH_HUMAN
More Information
SKU ASBPP-3671-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3671-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3075
Product information (PDF)
×
MSDS (PDF)
×