Recombinant Human CFL2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y281

Gene Name: CFL2

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met1

End Site: Leu166

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 81%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Cofilin-2; Cofilin; muscle isoform

Protein name: cofilin 2

Full length: 166 amino acids

Entry name: COF2_HUMAN

• SKU: ASBPP-4044-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4044-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1073