Recombinant Human CGGBP1 Protein

Recombinant Human CGGBP1 Protein
SKU
ASBPP-10366-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UFW8

Gene Name: CGGBP1

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Gly31

End Site: Ile140

Coverage: 0.73

Isoelectric Point: 9.5

Core Sequence: GGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 100%, Cynomolgus monkey - 98%

Alternative gene names: CGGBP

Alternative protein names: CGG triplet repeat-binding protein 1; CGG-binding protein 1; 20 kDa CGG-binding protein; p20-CGGBP DNA-binding protein

Protein name: CGG triplet repeat binding protein 1

Full length: 167 amino acids

Entry name: CGBP1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10366-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10366-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 8545
Product information (PDF)
×
MSDS (PDF)
×