Recombinant Human CGRRF1 Protein

Recombinant Human CGRRF1 Protein
SKU
ASBPP-3189-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q99675

Gene Name: CGRRF1

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 78%

Start Site: Tyr131

End Site: Asn270

Coverage: 0.44

Isoelectric Point: 5

Core Sequence: YSEYLYQEQYFIKKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDLKQLFMSANNNFTPSNNSSSEEKNTDRSLLEKVGLSESEVEPSEEN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Rat - 77%, Pig - 91%, Cynomolgus monkey - 99%

Alternative gene names: CGR19; RNF197

Alternative protein names: Cell growth regulator with RING finger domain protein 1; Cell growth regulatory gene 19 protein; RING finger protein 197

Protein name: cell growth regulator with ring finger domain 1

Full length: 332 amino acids

Entry name: CGRF1_HUMAN

Product panel: E3 Ligase
More Information
SKU ASBPP-3189-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3189-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10668
Product information (PDF)
×
MSDS (PDF)
×