Recombinant Human CHCHD1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96BP2

Gene Name: CHCHD1

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Ala11

End Site: Ala80

Coverage: 0.75

Isoelectric Point: 11

Core Sequence: ARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Pig - 89%, Cynomolgus monkey - 96%

Alternative gene names: C10orf34; MRPS37

Alternative protein names: Small ribosomal subunit protein mS37; 28S ribosomal protein S37; mitochondrial; MRP-S37; Coiled-coil-helix-coiled-coil-helix domain-containing protein 1; Nuclear protein C2360

Protein name: coiled-coil-helix-coiled-coil-helix domain containing 1

Full length: 118 amino acids

Entry name: CHCH1_HUMAN

• SKU: ASBPP-3076-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3076-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 118487