Recombinant Human CHMP4A Protein

Recombinant Human CHMP4A Protein
SKU
ASBPP-4035-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BY43

Gene Name: CHMP4A

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 63%

Start Site: Glu21

End Site: Trp220

Coverage: 0.90

Isoelectric Point: 4.5

Core Sequence: EAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 63%, Rat - 53%, Pig - 93%, Cynomolgus monkey - 97%

Alternative gene names: C14orf123; SHAX2

Alternative protein names: Charged multivesicular body protein 4a; Chromatin-modifying protein 4a; CHMP4a; SNF7 homolog associated with Alix-2; SNF7-1; hSnf-1; Vacuolar protein sorting-associated protein 32-1; Vps32-1; hVps32-1

Protein name: charged multivesicular body protein 4A

Full length: 222 amino acids

Entry name: CHM4A_HUMAN
More Information
SKU ASBPP-4035-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4035-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 29082
Product information (PDF)
×
MSDS (PDF)
×