Recombinant Human CHRDL2 Protein

Recombinant Human CHRDL2 Protein
SKU
ASBPP-3117-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6WN34

Gene Name: CHRDL2

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Gln181

End Site: Ala360

Coverage: 0.46

Isoelectric Point: 7.5

Core Sequence: QSDEEDSVQSLHGVRHPQDPCSSDAGRKRGPGTPAPTGLSAPLSFIPRHFRPKGAGSTTVKIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPTEYPCRHPEKVAGKCCKICPEDKADPGHSEISSTRCPKAPGRVLVHTSVSPSPDNLRRFALEHEA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 55%, Pig - 84%, Cynomolgus monkey - 99%

Alternative gene names: BNF1; CHL2

Alternative protein names: Chordin-like protein 2; Breast tumor novel factor 1; BNF-1; Chordin-related protein 2

Protein name: chordin like 2

Full length: 429 amino acids

Entry name: CRDL2_HUMAN
More Information
SKU ASBPP-3117-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3117-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 25884
Product information (PDF)
×
MSDS (PDF)
×