Recombinant Human Muscarinic Acetylcholine Receptor M3 Protein

Recombinant Human Muscarinic Acetylcholine Receptor M3 Protein
SKU
ASBPP-4391-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P20309

Gene Name: CHRM3

Expression System: Escherichia coli

Molecular Weight: 28 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Arg261

End Site: Ala490

Coverage: 0.40

Isoelectric Point: 9.5

Core Sequence: RTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 89%, Pig - 95%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Muscarinic acetylcholine receptor M3

Protein name: cholinergic receptor muscarinic 3

Full length: 590 amino acids

Entry name: ACM3_HUMAN
More Information
SKU ASBPP-4391-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4391-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1131
Product information (PDF)
×
MSDS (PDF)
×