Recombinant Human CHRM5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P08912

Gene Name: CHRM5

Expression System: Escherichia coli

Molecular Weight: 27 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 78%

Start Site: Glu221

End Site: Ala440

Coverage: 0.43

Isoelectric Point: 10

Core Sequence: EKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Rat - 79%, Pig - 82%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Muscarinic acetylcholine receptor M5

Protein name: cholinergic receptor muscarinic 5

Full length: 532 amino acids

Entry name: ACM5_HUMAN

• SKU: ASBPP-4366-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4366-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 1133