Recombinant Human CIART Protein

Recombinant Human CIART Protein
SKU
ASBPP-10485-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8N365

Gene Name: CIART

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Thr21

End Site: Thr180

Coverage: 0.43

Isoelectric Point: 10

Core Sequence: TSPVNSDFGFPSDSEREDKGAHGPRPDTVGQRGGSRPSPGPIRCRHRSKVSGNQHTPSHPKQRGSASPMAGSGAKRSRDGELETSLNTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Pig - 88%, Cynomolgus monkey - 98%

Alternative gene names: C1orf51

Alternative protein names: Circadian-associated transcriptional repressor; ChIP-derived repressor of network oscillator; Chrono; Computationally highlighted repressor of the network oscillator

Protein name: circadian associated repressor of transcription

Full length: 385 amino acids

Entry name: CIART_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10485-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10485-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 148523
Product information (PDF)
×
MSDS (PDF)
×