Recombinant Human CKB Protein

Recombinant Human CKB Protein
SKU
ASBPP-4091-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P12277

Gene Name: CKB

Expression System: Escherichia coli

Molecular Weight: 43.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Met1

End Site: Lys381

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: CKBB

Alternative protein names: Creatine kinase B-type; Brain creatine kinase; B-CK; Creatine kinase B chain; Creatine phosphokinase B-type; CPK-B

Protein name: creatine kinase B

Full length: 381 amino acids

Entry name: KCRB_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4091-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4091-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1152
Product information (PDF)
×
MSDS (PDF)
×