Recombinant Human CLC Protein

Recombinant Human CLC Protein
SKU
ASBPP-3212-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q05315

Gene Name: CLC

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%,72%

Start Site: Ser2

End Site: Arg142

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 34%, Pig - 58%, Cynomolgus monkey - 79%,Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 34%, Pig - 58%, Cynomolgus monkey - 79%

Alternative gene names: LGALS10; LGALS10A

Alternative protein names: Galectin-10; Gal-10; Charcot-Leyden crystal protein; CLC; Eosinophil lysophospholipase; Lysolecithin acylhydrolase

Protein name: Charcot-Leyden crystal galectin

Full length: 142 amino acids

Entry name: LEG10_HUMAN
More Information
SKU ASBPP-3212-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3212-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 1178
Product information (PDF)
×
MSDS (PDF)
×