Recombinant Human CLCN3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P51790

Gene Name: CLCN3

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Ser21

End Site: Lys120

Coverage: 0.13

Isoelectric Point: 4.5

Core Sequence: SASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEPIPGVGTYDDFHTIDWVREKCKDRERHRRINSKKKESAWEMTK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: H(+)/Cl(-) exchange transporter 3; Chloride channel protein 3; ClC-3; Chloride transporter ClC-3

Protein name: chloride voltage-gated channel 3

Full length: 818 amino acids

Entry name: CLCN3_HUMAN

• SKU: ASBPP-3168-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3168-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1182