Recombinant Human CLIC1 Protein

Recombinant Human CLIC1 Protein
SKU
ASBPP-3909-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O00299

Gene Name: CLIC1

Expression System: Escherichia coli

Molecular Weight: 28 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Met1

End Site: Lys241

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 99%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: G6; NCC27

Alternative protein names: Chloride intracellular channel protein 1; Chloride channel ABP; Nuclear chloride ion channel 27; NCC27; Regulatory nuclear chloride ion channel protein; hRNCC

Protein name: chloride intracellular channel 1

Full length: 241 amino acids

Entry name: CLIC1_HUMAN
More Information
SKU ASBPP-3909-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3909-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1192
Product information (PDF)
×
MSDS (PDF)
×