Recombinant Human COLQ Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y215

Gene Name: COLQ

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Asn301

End Site: Ser420

Coverage: 0.28

Isoelectric Point: 5

Core Sequence: NPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLTPFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCHRAYCGDGHRHEGVEDCDGS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 82%, Pig - 90%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Acetylcholinesterase collagenic tail peptide; AChE Q subunit; Acetylcholinesterase-associated collagen

Protein name: collagen like tail subunit of asymmetric acetylcholinesterase

Full length: 455 amino acids

Entry name: COLQ_HUMAN

• SKU: ASBPP-436-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-436-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 8292