Research Areas: Immunology
Uniprot: P07360
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-tagged
Purity: Greater than 85% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 26.4 kDa
Gene Names: C8G
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 21-202aa
Protein Length: Full length
Target Protein Sequence: QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
Endotoxin: Not test.
Relevance: C8 is a constituent of the membrane attack complex. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol.
Reference: "Structural and functional characterization of complement C8 gamma, a member of the lipocalin protein family."Haefliger J.-A., Peitsch M.C., Jenne D.E., Tschopp J.Mol. Immunol. 28:123-131(1991)
English
Deutsch
