Recombinant Human COPE Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O14579

Gene Name: COPE

Expression System: Escherichia coli

Molecular Weight: 35.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Met1

End Site: Ala308

Coverage: 1.00

Isoelectric Point: 5

Core Sequence: MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Pig - 94%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Coatomer subunit epsilon; Epsilon-coat protein; Epsilon-COP

Protein name: COPI coat complex subunit epsilon

Full length: 308 amino acids

Entry name: COPE_HUMAN

• SKU: ASBPP-3843-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3843-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 11316