Recombinant Human COPS8 Protein

Recombinant Human COPS8 Protein
SKU
ASBPP-3896-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q99627

Gene Name: COPS8

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Phe11

End Site: Ile180

Coverage: 0.85

Isoelectric Point: 7

Core Sequence: FSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 95%, Pig - 95%, Cynomolgus monkey - 100%

Alternative gene names: CSN8

Alternative protein names: COP9 signalosome complex subunit 8; SGN8; Signalosome subunit 8; COP9 homolog; hCOP9; JAB1-containing signalosome subunit 8

Protein name: COP9 signalosome subunit 8

Full length: 209 amino acids

Entry name: CSN8_HUMAN
More Information
SKU ASBPP-3896-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3896-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10920
Product information (PDF)
×
MSDS (PDF)
×