Recombinant Human coronavirus 229E Spike glycoprotein (S), partial

Research Areas: Microbiology

Uniprot: P15423

Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Form: Lyophilized powder

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 17.2 kDa

Gene Names: S

Organism: Human coronavirus 229E (HCoV-229E)

Source: E.coli

Expression Region: 785-873aa

Protein Length: Partial

Target Protein Sequence: DVLQENQKILAASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNSLNHLTSQLRQNFQAISSSIQAIYDRLDTIQ

Endotoxin: Not test.

• SKU: CSB-EP321366HIT-20
• Manufacturer: Cusabio
• Manufacturer SKU: CSB-EP321366HIT-20
• Package Unit: 20 µg
• Quantity Unit: STK