Recombinant Human CPHXL Protein

Recombinant Human CPHXL Protein
SKU
ASBPP-3151-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A0A1W2PPM1

Gene Name: CPHXL

Expression System: Escherichia coli

Molecular Weight: 31.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 42%

Start Site: Pro11

End Site: Lys270

Coverage: 0.66

Isoelectric Point: 8

Core Sequence: PAEEDHHNEERQTKNKRKTKHRHKFSEELLQELKEIFGENCYPDYTTRKTLAIKFDCPVNVIDNWFQNKRARLPPAERRRIFVLQKKHDFPVQAHSFLSCQETQAAAHNYATKQSLSGAQRALMRRAGCSHLEKQWIPSQEMGYNCFSLENQETPSQQVGPQCSYLEKPGIPSQQVGSQCSYLEKLGIPSQQVASQSSYLVTGTEKHPGCAMGYGGDTGSGHSGSGHSTAYHFLSYNSAECLHPPPSSVPYFHGERTETK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 42%, Rat - 37%, Pig - 40%, Cynomolgus monkey - 77%

Alternative gene names: CPHX1

Alternative protein names: Cytoplasmic polyadenylated homeobox-like protein; Cytoplasmic polyadenylated homeobox 1

Protein name: cytoplasmic polyadenylated homeobox like

Full length: 405 amino acids

Entry name: CPHXL_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3151-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3151-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 105371346
Product information (PDF)
×
MSDS (PDF)
×