Recombinant Human CRH Protein

Recombinant Human CRH Protein
SKU
ASBPP-3066-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P06850

Gene Name: CRH

Expression System: Escherichia coli

Molecular Weight: 31 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 74%

Start Site: Val31

End Site: Leu190

Coverage: 0.87

Isoelectric Point: 7

Core Sequence: VPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 74%, Rat - 74%, Pig - 83%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Corticoliberin; Corticotropin-releasing factor; CRF; Corticotropin-releasing hormone

Protein name: corticotropin releasing hormone

Full length: 196 amino acids

Entry name: CRF_HUMAN

Product panel: Neuroscience Biomarkers
More Information
SKU ASBPP-3066-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3066-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1392
Product information (PDF)
×
MSDS (PDF)
×