Recombinant Human CSRP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P21291

Gene Name: CSRP1

Expression System: Escherichia coli

Molecular Weight: 33 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met1

End Site: Glu193

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: CSRP; CYRP

Alternative protein names: Cysteine and glycine-rich protein 1; Cysteine-rich protein 1; CRP; CRP1; Epididymis luminal protein 141; HEL-141

Protein name: cysteine and glycine rich protein 1

Full length: 193 amino acids

Entry name: CSRP1_HUMAN

• SKU: ASBPP-3145-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3145-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 1465