Recombinant Human CSRP2 Protein

Recombinant Human CSRP2 Protein
SKU
ASBPP-3157-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q16527

Gene Name: CSRP2

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Lys91

End Site: Cys170

Coverage: 0.48

Isoelectric Point: 9

Core Sequence: KPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: LMO5; SMLIM

Alternative protein names: Cysteine and glycine-rich protein 2; Cysteine-rich protein 2; CRP2; LIM domain only protein 5; LMO-5; Smooth muscle cell LIM protein; SmLIM

Protein name: cysteine and glycine rich protein 2

Full length: 193 amino acids

Entry name: CSRP2_HUMAN
More Information
SKU ASBPP-3157-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3157-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1466
Product information (PDF)
×
MSDS (PDF)
×