Recombinant Human CST6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q15828

Gene Name: CST6

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 37%

Start Site: Arg29

End Site: Met149

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 37%, Rat - 37%, Pig - 78%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Cystatin-M; Cystatin-6; Cystatin-E

Protein name: cystatin E/M

Full length: 149 amino acids

Entry name: CYTM_HUMAN

• SKU: ASBPP-3206-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3206-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 1474