Recombinant Human CSTF2 Protein

Recombinant Human CSTF2 Protein
SKU
ASBPP-3107-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P33240

Gene Name: CSTF2

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Gly21

End Site: Ser120

Coverage: 0.19

Isoelectric Point: 4.5

Core Sequence: GNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETIS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 37%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Cleavage stimulation factor subunit 2; CF-1 64 kDa subunit; Cleavage stimulation factor 64 kDa subunit; CSTF 64 kDa subunit; CstF-64

Protein name: cleavage stimulation factor subunit 2

Full length: 577 amino acids

Entry name: CSTF2_HUMAN
More Information
SKU ASBPP-3107-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3107-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1478
Product information (PDF)
×
MSDS (PDF)
×