Recombinant Human CSTF2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P33240

Gene Name: CSTF2

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Gly21

End Site: Ser120

Coverage: 0.19

Isoelectric Point: 4.5

Core Sequence: GNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETIS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 37%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Cleavage stimulation factor subunit 2; CF-1 64 kDa subunit; Cleavage stimulation factor 64 kDa subunit; CSTF 64 kDa subunit; CstF-64

Protein name: cleavage stimulation factor subunit 2

Full length: 577 amino acids

Entry name: CSTF2_HUMAN

• SKU: ASBPP-3107-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3107-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 1478