Recombinant Human CWC25 Protein

Recombinant Human CWC25 Protein
SKU
ASBPP-10428-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NXE8

Gene Name: CWC25

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Ser11

End Site: Met80

Coverage: 0.19

Isoelectric Point: 8

Core Sequence: SWHPQTLRNVEKVWKAEQKHEAERKKIEELQRELREERAREEMQRYAEDVGAVKKKEEKLDWMYQGPGGM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 34%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: CCDC49

Alternative protein names: Pre-mRNA-splicing factor CWC25 homolog; Coiled-coil domain-containing protein 49; Spliceosome-associated protein homolog CWC25

Protein name: CWC25 spliceosome associated protein homolog

Full length: 425 amino acids

Entry name: CWC25_HUMAN
More Information
SKU ASBPP-10428-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10428-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 54883
Product information (PDF)
×
MSDS (PDF)
×